PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen06g023350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 232aa    MW: 26877.8 Da    PI: 9.665
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen06g023350.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.64.4e-30959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien++nrqvtf+kRrng+lKKA+ELSvLC+ae+a+i+fs++g++yeys+
  Sopen06g023350.1  9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSTRGRVYEYSN 59
                      79***********************************************95 PP

2K-box99.45.3e-33791738100
             K-box   8 s..leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                       +  ++e +a+ +qqe++kL+++i+++q+++Rhl+Ge+L+ L+++eL+qLe++Le+++++iRskK+e++l+++e+lqk+e  l++en  Lr+k+
  Sopen06g023350.1  79 ActTQELNAQFYQQESKKLRQQIQMMQNSNRHLVGEGLSCLNVRELKQLENRLERGISRIRSKKHEMILAETENLQKREILLEQENAFLRSKI 171
                       23478899************************************************************************************9 PP

             K-box  99 ee 100
                       +e
  Sopen06g023350.1 172 AE 173
                       86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.2E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.179161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.5E-32276IPR002100Transcription factor, MADS-box
CDDcd002651.31E-41274No hitNo description
PRINTSPR004041.8E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-313859IPR002100Transcription factor, MADS-box
PfamPF014867.0E-2583171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.84787177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCE AEIALIVFST RGRVYEYSNN  60
NIKATIERYK KATAETSNAC TTQELNAQFY QQESKKLRQQ IQMMQNSNRH LVGEGLSCLN  120
VRELKQLENR LERGISRIRS KKHEMILAET ENLQKREILL EQENAFLRSK IAENERLQEL  180
SMMPAAGGQD YSAIQQYLAR NMLQLNMMEG QGVSSYDPLP PPHHDKKSLE LQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-20169169Myocyte-specific enhancer factor 2B
1tqe_Q5e-20169169Myocyte-specific enhancer factor 2B
1tqe_R5e-20169169Myocyte-specific enhancer factor 2B
1tqe_S5e-20169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010322781.11e-170PREDICTED: agamous-like MADS-box protein AGL11 isoform X2
RefseqXP_015078664.11e-170PREDICTED: agamous-like MADS-box protein AGL11 isoform X2
RefseqXP_010322780.11e-170PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
RefseqXP_004241906.11e-170PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
RefseqXP_015078663.11e-170PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
SwissprotQ388363e-97AGL11_ARATH; Agamous-like MADS-box protein AGL11
TrEMBLA0A0V0I1K31e-169A0A0V0I1K3_SOLCH; Putative agamous-like MADS-box protein AGL11-like
STRINGPGSC0003DMT4000132481e-168(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.12e-98MIKC_MADS family protein